Protein Info for AMB_RS06260 in Magnetospirillum magneticum AMB-1

Annotation: NAD+ synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 52% identical to NADE_RHOCA: Glutamine-dependent NAD(+) synthetase (nadE) from Rhodobacter capsulatus

KEGG orthology group: K01916, NAD+ synthase [EC: 6.3.1.5] (inferred from 100% identity to mag:amb1233)

Predicted SEED Role

"NAD synthetase (EC 6.3.1.5) / Glutamine amidotransferase chain of NAD synthetase" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 6.3.1.5)

MetaCyc Pathways

aspartate superpathway (22/25 steps found)
NAD de novo biosynthesis I (6/6 steps found)
NAD salvage pathway II (PNC IV cycle) (5/5 steps found)
NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (4/4 steps found)
NAD de novo biosynthesis III (5/6 steps found)
NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
NAD salvage pathway I (PNC VI cycle) (4/7 steps found)
NAD salvage pathway V (PNC V cycle) (2/5 steps found)
NAD de novo biosynthesis II (from tryptophan) (4/9 steps found)
NAD salvage (plants) (4/11 steps found)
superpathway of NAD biosynthesis in eukaryotes (4/14 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7Y8 at UniProt or InterPro

Protein Sequence (551 amino acids)

>AMB_RS06260 NAD+ synthase (Magnetospirillum magneticum AMB-1)
MSDTLSIALAQINPVVGDIAGNMALIRAARAEAQVLGADLVVFGELTLCGYPPEDLVLKG
AFLDACEAAVEELAAETEGGPALLVGAPWRVKDRLHNAALLLDHGRVAATRLKHHLPNYG
VFDEIRVFQPGPAPGPVSFRGVRLGIMICEDMWYADVAETLGESGAEILVVPNGSPYEMD
KPTKRLDHARARVEETGLPLIYVNQVGGQDELVFDGASFVLDSDGATAASIAPWQSQVIL
TRWTRGSGGWRCDGPKAPPVSRLEGVYQALVTGLRDYVGKNRFPGVVLGLSGGIDSAICA
AIAADALGPDKVWCVMMPSPYTSEESLEDAAECARLLGVRLDTVNIGPAMGAFETMLAPL
FAGKDADITEENLQSRSRGLTLMGISNKFGPMVLSTGNKSEMSCGYATLYGDMCGGYAVL
KDVYKTTVFALSSWRNGQRPPGCLGPQGRVMPDRVITKPPSAELKPDQKDQDTLPPYDEL
DAMLEAMIEDEKSVAEIVAAGYDEAVVRRVWRMLDRAEYKRRQAPPGVKITSRSFGKDRR
YPITNAFTALI