Protein Info for AMB_RS06190 in Magnetospirillum magneticum AMB-1

Annotation: 3-deoxy-7-phosphoheptulonate synthase class II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 88 to 104 (17 residues), see Phobius details PF01474: DAHP_synth_2" amino acids 5 to 442 (438 residues), 721.4 bits, see alignment E=1.5e-221 TIGR01358: 3-deoxy-7-phosphoheptulonate synthase" amino acids 5 to 448 (444 residues), 730 bits, see alignment E=3.9e-224

Best Hits

Swiss-Prot: 64% identical to AROF_ARATH: Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic (DHS1) from Arabidopsis thaliana

KEGG orthology group: K01626, 3-deoxy-7-phosphoheptulonate synthase [EC: 2.5.1.54] (inferred from 100% identity to mag:amb1219)

Predicted SEED Role

"2-keto-3-deoxy-D-arabino-heptulosonate-7-phosphate synthase II (EC 2.5.1.54)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.5.1.54)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W802 at UniProt or InterPro

Protein Sequence (462 amino acids)

>AMB_RS06190 3-deoxy-7-phosphoheptulonate synthase class II (Magnetospirillum magneticum AMB-1)
MSENWSPESWRAKPIHQAPTYPDSAKLAEVEESLRNFPPLVFAGEARRLKASLADVADGK
AFLLQGGDCAESFAEFHANNIRDTFRVLLQMAVVLTYGAAMPVVKVGRMAGQFAKPRSAD
TETIDGVTLPSYRGDNVNGSEFTAEARVPDPLRMIRAYNQSAATLNLLRAFAQGGYADLH
KVHQWTLGCVAGTLQAARYQDLCDRLDETLAFMEACGMTSDTTPQLRETDFFTSHEALLM
PYEQALTRIDSTTGDWYDCSAHMLWIGERTRQMDAGHVEFLRGVKNPLGFKAGPGMSPDD
LLRLIDRLNPENESGRITVITRMGAEKVEQVLPGLIRAVEREGRKVVWSCDPMHANTIKA
AGGYKTRPFDAILAEVRAFFAVHKAEGSHAGGVHFEMTGQDVTECIGGMTGVAEEDLGDR
YQTACDPRLNATQSLELAFLIAEQLKDERALLRAKAKAKRKD