Protein Info for AMB_RS06165 in Magnetospirillum magneticum AMB-1

Annotation: CBS domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 880 PF00571: CBS" amino acids 46 to 93 (48 residues), 29.6 bits, see alignment 2.8e-10 amino acids 107 to 158 (52 residues), 29.8 bits, see alignment 2.5e-10 amino acids 172 to 227 (56 residues), 29.3 bits, see alignment 3.6e-10 amino acids 236 to 290 (55 residues), 32.4 bits, see alignment 3.9e-11 PF13188: PAS_8" amino acids 320 to 359 (40 residues), 33 bits, see alignment (E = 1.6e-11) TIGR00229: PAS domain S-box protein" amino acids 320 to 437 (118 residues), 82.7 bits, see alignment E=2.3e-27 PF00989: PAS" amino acids 320 to 428 (109 residues), 44.7 bits, see alignment E=4.9e-15 PF08448: PAS_4" amino acids 324 to 432 (109 residues), 35.5 bits, see alignment E=4e-12 PF13426: PAS_9" amino acids 328 to 430 (103 residues), 64.3 bits, see alignment E=4.4e-21 PF08447: PAS_3" amino acids 340 to 423 (84 residues), 35.6 bits, see alignment E=3.6e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 439 to 602 (164 residues), 160.5 bits, see alignment E=3.1e-51 PF00990: GGDEF" amino acids 442 to 598 (157 residues), 188.2 bits, see alignment E=3.7e-59 PF00563: EAL" amino acids 620 to 859 (240 residues), 238.2 bits, see alignment E=3.5e-74

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1214)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W807 at UniProt or InterPro

Protein Sequence (880 amino acids)

>AMB_RS06165 CBS domain-containing protein (Magnetospirillum magneticum AMB-1)
MTMVLRRPASPWGVAPPAELGETGRRALVSSQDKSSVSSDQTIDRIVQKTLLNCSPASTI
LEAAQAMAAAHCSSIVVVEDGKPVGIWTERDALAINIADPQAFQRPISDVMSTPVKTIRT
GSTIGDTGMRFKLEGVRHFVVVDEAGEAMGIVSQSDVILGHGVEHFLVLRPVRSAISRPM
VTIPNDASLAQAVTQLRNARADAAIVLGEGDLPPGIITERDVLRLIAGTGPIPATVGEVA
SRPLLTITEEDSLLAARAMLEQKHIRHIGITRMDGELVGLLSFSDILATLQYEYVHRLDE
ALKERDAALLRSRKDLNLARKVIEASLDGIMIVDSTQKIEFVNPAFTHMTGYTAEEIIGK
NPNVLKSGHHDETFYKHMYTVLEAQDYWQGEIWNRRKNGEIYPEWLTINVIRDDTGDITQ
YAAIFSDITERKKTEERIKNLAYFDVLTALPNRRLFTDRLQIAIANAHRHGQQLAIMFLD
LDLFKRINDSLGHGVGDQVLVETAARISHCVREGDTVARLGGDEFTVLLPELDHLEDVAK
LAERVIAHVKQPFLVDDNELYVTTSIGIAVYPEDGTTVEALIKNADTAMYRAKDLGRNSY
QLYTAAMNARSFERLTMESSLRHALTREEFRLVYQVKVDSEDGRMSGVEALVRWHHPEMG
LVSPVDFIPLAEAMGVISDIGEWVLRTACRQCKHWMDLGLPPVRIAVNVSAQQFVETDVP
EVVARALRETGLPPQYLELELTETVLMQRVDEVVAVLKSLRAMGVRISIDDFGTGYSSLS
YLKRMPIDALKVDRSFVNDIFDGQSKVTEDGAEIVSTIINLAHNLKLKAIAEGVETPEQA
EFLRSKGCDEVQGYLISRPVSGEDLISLFDRNLLPQGKVD