Protein Info for AMB_RS06145 in Magnetospirillum magneticum AMB-1

Annotation: FUSC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 30 to 52 (23 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 149 to 172 (24 residues), see Phobius details amino acids 193 to 215 (23 residues), see Phobius details amino acids 221 to 240 (20 residues), see Phobius details amino acids 251 to 279 (29 residues), see Phobius details amino acids 286 to 309 (24 residues), see Phobius details amino acids 322 to 342 (21 residues), see Phobius details PF13515: FUSC_2" amino acids 209 to 334 (126 residues), 95.9 bits, see alignment E=1e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1210)

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W811 at UniProt or InterPro

Protein Sequence (364 amino acids)

>AMB_RS06145 FUSC family protein (Magnetospirillum magneticum AMB-1)
MMPPWNRFLRLLSEELRHFTTIHPSDRSWQMPLAAALASGLPLLVGCSFDRLDYGMVSSL
GGMVFLYLPPTPLYHRMVLLMASAFAMIACYTLGMMSHLIPVLMMPVLVFIAILTTMLCR
YYRVGVPGSLFFIMAASIGAYSPVELLQIPLMVGLLSMGALLASLIAFFYSLEMLRLRPA
APIEPLPPASFDFVIFDSVVIGAFVGASLALAQVLHLEKAYWVPVSCLAVIQGTSLRAVW
NRQIHRIVGTGLGMLLAWGLLSLPLNNWGIAVTMMLLTFAIETAIVRHYAFAVVLITPLT
ILLAEAATMGQGSAAELIQSRFIDTCLGSFVGLLGGICIHSPRFRAVTGKYLRRLIPTRF
QPPA