Protein Info for AMB_RS06115 in Magnetospirillum magneticum AMB-1

Annotation: cation transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 152 to 169 (18 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details PF01545: Cation_efflux" amino acids 22 to 196 (175 residues), 50.2 bits, see alignment E=1.4e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1205)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W816 at UniProt or InterPro

Protein Sequence (208 amino acids)

>AMB_RS06115 cation transporter (Magnetospirillum magneticum AMB-1)
MSGCCEGQCEGAKDDPRYLRILQVAFAVNTTMFLVEVVAGLFAGSAALQADALDFLSDAA
NYGISLFVLGKALRHRAIAAMVKGSSMAAFGLWVLGSTAWHAWFGSLPKAEIMGAVGFLA
LAANGTVAALLFTYRNGDANMRSVWVCSRNDAIANVAVMLAATGVFATGTHWPDIIVAAL
IGGLNLTGAVGVMAQASREIRRTTPATG