Protein Info for AMB_RS05720 in Magnetospirillum magneticum AMB-1

Annotation: argininosuccinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00764: Arginosuc_synth
  • amino acids 7 to 170 (164 residues), 208.6 bits, E=6.1e-66
• TIGR00032: argininosuccinate synthase
  • amino acids 7 to 400 (394 residues), 467.8 bits, E=1.8e-144
• PF20979: Arginosuc_syn_C
  • amino acids 181 to 398 (218 residues), 275 bits, E=4.6e-86

Best Hits

Swiss-Prot: 100% identical to ASSY_MAGSA: Argininosuccinate synthase (argG) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K01940, argininosuccinate synthase [EC: 6.3.4.5] (inferred from 100% identity to mag:amb1125)

Predicted SEED Role

"Argininosuccinate synthase (EC 6.3.4.5)" in subsystem Arginine Biosynthesis extended (EC 6.3.4.5)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• nitric oxide biosynthesis II (mammals) (2/3 steps found)
• urea cycle (3/5 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• canavanine biosynthesis (2/4 steps found)
• superpathway of arginine and polyamine biosynthesis (11/17 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.5

Sequence Analysis Tools

See Q2W896 at UniProt or InterPro

Protein Sequence (404 amino acids)

>AMB_RS05720 argininosuccinate synthase (Magnetospirillum magneticum AMB-1)
MKGEVKKVVLAYSGGLDTSIILRWLQDQYQCEVVTFTADLGQGEELEPARAKARLMGIKE
ENIFIDDLREEFVRDFVFPMFRANALYEGVYLLGTSIARPLISKRQIEIANMVGADAVSH
GATGKGNDQVRFEMGYYALKPDIKVIAPWRLWDLTSRTKLLDFAEKHQIPIAKDKRGEAP
YSTDANLLHISYEGKALEDPWVEPFEDMYTRSVAPENAPDKPTYIEIEFEKGDAVAIDGV
RLSPAALLTKLNELGGANGIGRLDLVENRFVGMKSRGVYETPGGSVLIVAHRAMESLTLD
RGESHLKDELMPRYAELIYNGFWFAPERIAIQTMIDKVSENVSGTVRLKLFKGVASVVGR
KSPKSLYRMDYVTFEEDSVYDQRDAQGFIKLNALRMRLAKMARG