Protein Info for AMB_RS05700 in Magnetospirillum magneticum AMB-1

Annotation: ATP-dependent Clp protease adapter ClpS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 PF02617: ClpS" amino acids 27 to 106 (80 residues), 128.3 bits, see alignment E=3.7e-42

Best Hits

Swiss-Prot: 100% identical to CLPS_MAGSA: ATP-dependent Clp protease adapter protein ClpS (clpS) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K06891, ATP-dependent Clp protease adaptor protein ClpS (inferred from 100% identity to mag:amb1122)

Predicted SEED Role

"ATP-dependent Clp protease adaptor protein ClpS" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W899 at UniProt or InterPro

Protein Sequence (110 amino acids)

>AMB_RS05700 ATP-dependent Clp protease adapter ClpS (Magnetospirillum magneticum AMB-1)
MSENGNDKRDGDDGQTGVVIKTRPKTKKPSMYKVLMLNDDYTPMEFVVHVLERFFNKSRE
DATRVMLHVHTRGVGICGVYTYEVAETKVTQVMDLARQNQHPLQCTIEKE