Protein Info for AMB_RS05670 in Magnetospirillum magneticum AMB-1

Annotation: response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 PF00072: Response_reg" amino acids 4 to 116 (113 residues), 93.1 bits, see alignment E=6.3e-31

Best Hits

Swiss-Prot: 39% identical to DIVK_OCHA4: Polar-differentiation response regulator DivK (divK) from Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / JCM 21032 / NBRC 15819 / NCTC 12168)

KEGG orthology group: None (inferred from 76% identity to bja:blr2285)

Predicted SEED Role

"Circadian input kinase A" in subsystem Cyanobacterial Circadian Clock

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (122 amino acids)

>AMB_RS05670 response regulator (Magnetospirillum magneticum AMB-1)
MARILLVEDNEMNRDMLSRRLQRKGYEVVMAVDGGEGVAMAASENPDLILMDMSLPVLNG
WDATRQIKASPALARIPIIALTAHAMASDREQALAAGCDGYETKPIELPQLLEKIETLLR
RA