Protein Info for AMB_RS05500 in Magnetospirillum magneticum AMB-1

Annotation: GDP-mannose 4,6 dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF01370: Epimerase" amino acids 5 to 245 (241 residues), 186.9 bits, see alignment E=4.3e-59 PF16363: GDP_Man_Dehyd" amino acids 6 to 308 (303 residues), 327.6 bits, see alignment E=1.1e-101

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1076)

Predicted SEED Role

"GDP-mannose 4,6-dehydratase (EC 4.2.1.47)" in subsystem Capsular heptose biosynthesis or Colanic acid biosynthesis (EC 4.2.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.47

Use Curated BLAST to search for 4.2.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8E5 at UniProt or InterPro

Protein Sequence (331 amino acids)

>AMB_RS05500 GDP-mannose 4,6 dehydratase (Magnetospirillum magneticum AMB-1)
MAKTALVFGISGQDGAYLASLLLAKGYRVIGASRDAEGSSFANLRELGILEQISLRSACM
NDFHAILKVISETQPDEIYNLSGQSSVGLSFEQPLPTFESIVGGTLNILEAVRFLNASIR
FYNAASGECFGNTQGVAASEQAPFRPRSPYAVAKASAAMAVVNYREAYGMFACSGFLFNH
ESPFRPHRFVTRKVVRAAARIARGEDLRLMLGDISVRRDWGWAPEYVDAMWRMLNVDEPE
DIVIATGIHASLQEFVETVFGFFDLDWRAHVDIDPGLRRPSDVAISFGDPSRALQRLGWR
ASFTMPDVACAMAKAEAGSEPAAGGEVEKSL