Protein Info for AMB_RS05495 in Magnetospirillum magneticum AMB-1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 891 transmembrane" amino acids 48 to 59 (12 residues), see Phobius details amino acids 71 to 104 (34 residues), see Phobius details amino acids 116 to 134 (19 residues), see Phobius details amino acids 141 to 157 (17 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 195 to 218 (24 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 287 to 303 (17 residues), see Phobius details amino acids 317 to 337 (21 residues), see Phobius details amino acids 357 to 377 (21 residues), see Phobius details amino acids 384 to 401 (18 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1075)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8E6 at UniProt or InterPro

Protein Sequence (891 amino acids)

>AMB_RS05495 hypothetical protein (Magnetospirillum magneticum AMB-1)
MIYTVVADVWGVRFTTFDDARAAIWAYDNSEINTIAFGQGRLYFFYHSPFVTFGNSLWRT
VAFDIVQHGGFALAIAFVVATLSLYISLTFGLLAGFIYLATLAVTWDHTLITSVPLFHYV
VVVNMSATLMALYAYRRTGRWLWLGASLALYFLALWGQEYQIMIITALFIVCAFARLPGQ
APAGAESGPDRRKMIRLCGAAISLGAAYAVAVIVWRLIYGNQYDGAEISAATFSLKHFLG
VLLLWPFGTNIFAYIVHPLHVGASMAGNGFDYRLDFAPATVLANLDGLTPVKIAAVLLGG
ALLMRHLRRDELSRGQLLILPLLAGVIMLAPTFLLGLTPKYQGWFQQGTPAYSYSSISAY
GVAILLAWLAVGVHGLVDGGAWRWTIRGGVVAVLLVGAVAADSQNNVVGRAMREATARWI
SLNMVLTSPLRPEIEDGTLYAPRLADYYWAVPGYPDYWRRLLKIAYGSKIVYKDAVDITD
TFGDKSYYFDYAYLPESRRNVALLSKVVQEGNVPTTRQVRLISDGPLDTALAGVKKDGTA
LHVWLPRMPVQRMGKAFVYTVNLPESTPVAWLRVESQRMWAPPKALKSPIYKMSSPIDFS
DRGNSRAFLGDGWSTPEAQLTWAVGSESEVRLLPSKQSGCDVKGTVKAWPFYVKDKSPDP
EVTILVNGDQMWKGSIWRDTAIDFTIPAAVWNRDRFVSLKLLHPYARSPQELGVSSDGRK
LALAVQSMTFQGCGASEGAPYELGDTIDFRDVGNAKPYMTEGWSDPERDLTWAIGPQSSL
VLGHATVPACDVVMEISASAHALPPKLAQPPLTVEVNGKVVGDGTGFDAQAAKQSFTIDR
MLWLSEQPARIRFNHPYAKSPKDLGTSQDPRPLAFAFRSLSVKERCRSGLR