Protein Info for AMB_RS05490 in Magnetospirillum magneticum AMB-1

Annotation: glycosyltransferase family 2 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 transmembrane" amino acids 280 to 299 (20 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 36 to 257 (222 residues), 43.7 bits, see alignment E=3.1e-15 PF00535: Glycos_transf_2" amino acids 39 to 154 (116 residues), 93 bits, see alignment E=2.1e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1074)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8E7 at UniProt or InterPro

Protein Sequence (359 amino acids)

>AMB_RS05490 glycosyltransferase family 2 protein (Magnetospirillum magneticum AMB-1)
MLMNPPPADSRLRPRRPFLLPDVGPRRVKPPASIQPAVSVLIVTYNSAAHIRQCLECLRE
QTYEDFEVLVVDCASADGSHGVAVKAADGDTRFHFLPQGRNLGFAAGNNLAARAARGRWL
ACLNPDAFAEPDWLQQLMDATIRYPFADMFGSTQFDAGNPALLDGCGDLYHAVGLAWRAG
HGGPISSLPRDREVFSPCAAASLYRADGFNSLGGFDERFFCFMEDVDLAFRWRLTGGRCI
QVRNAAVHHVGGASAGRTSAFARYHGLRNALWCFAKNMPTPLLACLLLPHLALLAALVAR
DIRRGQGKAAVRAVRDGLLGLRAVLADRAVVQRRRTLAVIDLSRKFTWSLRALWRREAP