Protein Info for AMB_RS04975 in Magnetospirillum magneticum AMB-1

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 PF13432: TPR_16" amino acids 55 to 117 (63 residues), 25.5 bits, see alignment E=1.1e-08 amino acids 124 to 184 (61 residues), 36.4 bits, see alignment E=4.2e-12 amino acids 165 to 218 (54 residues), 20.1 bits, see alignment E=5.5e-07 PF14559: TPR_19" amino acids 62 to 123 (62 residues), 35.9 bits, see alignment E=5.8e-12 amino acids 132 to 192 (61 residues), 26.2 bits, see alignment E=6.1e-09 PF13181: TPR_8" amino acids 154 to 184 (31 residues), 20.1 bits, see alignment 4e-07 amino acids 192 to 217 (26 residues), 17.4 bits, see alignment (E = 2.9e-06) PF13174: TPR_6" amino acids 155 to 181 (27 residues), 13.4 bits, see alignment (E = 8e-05) PF13176: TPR_7" amino acids 157 to 187 (31 residues), 17.4 bits, see alignment 2.8e-06

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0971)

Predicted SEED Role

"TPR-repeat-containing protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8Q0 at UniProt or InterPro

Protein Sequence (221 amino acids)

>AMB_RS04975 tetratricopeptide repeat protein (Magnetospirillum magneticum AMB-1)
MENTMSSKPSDILDEVTLYAHYGLSVAKKLGMNMVDAFRAAFSVNDDIRQVYYRDKGISH
AKAGRYSQAVMLLEQVYDADAFDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKV
ATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALDNLGRFDEAIDSFKIALG
LRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELDEGASV