Protein Info for AMB_RS04820 in Magnetospirillum magneticum AMB-1

Annotation: 4Fe-4S binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 transmembrane" amino acids 38 to 59 (22 residues), see Phobius details amino acids 79 to 104 (26 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 154 to 173 (20 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 274 to 296 (23 residues), see Phobius details amino acids 333 to 360 (28 residues), see Phobius details amino acids 385 to 405 (21 residues), see Phobius details amino acids 413 to 434 (22 residues), see Phobius details amino acids 453 to 476 (24 residues), see Phobius details PF12801: Fer4_5" amino acids 80 to 123 (44 residues), 27.9 bits, see alignment 9.6e-11 amino acids 160 to 198 (39 residues), 26.6 bits, see alignment 2.5e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0938)

Predicted SEED Role

"Polyferredoxin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8T3 at UniProt or InterPro

Protein Sequence (478 amino acids)

>AMB_RS04820 4Fe-4S binding protein (Magnetospirillum magneticum AMB-1)
MNNKSFDEVRTKASVRPVSARKVAAAVEEFFVRNRTWLSWVHAAMFLVFLGIILVPVFLP
DPPGNATPLTHYTTFTNYLLWGLWFPLVFMSVIVTGRSWCGLLCPMGAAAEKANAYGPKF
KIPRWLSWEGTPVVSFLIVTIIGQTVGVRDHPEAAAEVFGGTMLAAIIIGWLFGSKKRAW
CRHACPIGLLLGVFSRLGAVEFAPWTRKSTTEGYTDRGVCPTLIDISRKTESRHCIECFR
CVNPSAKGGVHLEFRKPGKEIERIRDHHANPVEVWFLFLGTGIALGGFLWLVLPIFQKMR
QSLGVWSIHNGLTWMGQPGPAWLMSVHPERNEIFLWLDFVMITGFMTGCMVLLAVVLAAF
TSCSSALAGRAGGDGTFGSRFTELGYQYTPVAMVSLIIGLGGKLFEPIAYTPLGIDGVHG
AKGLLFVIGLLWSIRLGERILARQGVAASRRWLPLLPGLIGTLAVGLGWWPAIFGLMK