Protein Info for AMB_RS04775 in Magnetospirillum magneticum AMB-1

Annotation: integrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 166 to 182 (17 residues), see Phobius details PF13495: Phage_int_SAM_4" amino acids 7 to 83 (77 residues), 62 bits, see alignment E=8.5e-21 PF02899: Phage_int_SAM_1" amino acids 17 to 79 (63 residues), 34.6 bits, see alignment E=2.9e-12 PF00589: Phage_integrase" amino acids 105 to 264 (160 residues), 143.5 bits, see alignment E=8.8e-46

Best Hits

Swiss-Prot: 52% identical to Y4QK_SINFN: Putative integrase/recombinase y4qK (NGR_a01870) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 100% identity to mag:amb0926)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8U5 at UniProt or InterPro

Protein Sequence (285 amino acids)

>AMB_RS04775 integrase (Magnetospirillum magneticum AMB-1)
MAEMSPLRRRMIEDMTVRNLSPATQRSYLHAVSKFSRFFNRSPDRLDHDDVRTWQVHLVS
QGISWASLNQFVAALRFFYGVTLRCPEIPERIVYARQPRRLPIVLSADEVVRFLEAVPSL
KNRTALTTAYATGLRVSEVVALKLADIDSGRMVIRVEQGKGRKDRYVMLSAQLLGILRTY
WPLARPEHWLFPGREDKPIEPTVLNSACRSACVAAGIDKRVTVHTLRHSFATHLLEAGTD
IRIIQVLLGHNNLSTTARYTQVSNAMIAKTTSPLDGLDLMVVPPS