Protein Info for AMB_RS04735 in Magnetospirillum magneticum AMB-1

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 PF12860: PAS_7" amino acids 45 to 157 (113 residues), 115.6 bits, see alignment E=2e-37 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 193 to 352 (160 residues), 147.9 bits, see alignment E=2.2e-47 PF00990: GGDEF" amino acids 197 to 350 (154 residues), 140.9 bits, see alignment E=4.8e-45 TIGR02481: hemerythrin-like metal-binding domain" amino acids 376 to 497 (122 residues), 83.1 bits, see alignment E=1.7e-27 PF01814: Hemerythrin" amino acids 384 to 498 (115 residues), 38.8 bits, see alignment E=1.9e-13

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (509 amino acids)

>AMB_RS04735 diguanylate cyclase (Magnetospirillum magneticum AMB-1)
MMDDGRNQHGGDQHGGDQHGGDQDIGHLLKLVEIPEYLSMIQPIIDHLPCGVAVFDPSLN
MVVCNGVFRRLLDLPDELFTAGLPSLKKLATFAAERGEYGPGNPEELAEQVVQRAMAMEP
NQFERVRPDETILEIDERPLPNGGFVTLYTDITERRALAERSRDLEALNLELTNTVAALA
ASNAELHAAREELEHLAQRDGLTGAWTRRRIEETAQQEMLRKARYGHPVSLLFIDLDHFK
RVNDTHGHAVGDDVLKAFCNIARKCMRSTDLLGRWGGEEFVILMPNSGVMIASLLAERIR
KATMAFEFPIVGRVTTSLGIAECREDETWDSWLARSDAALYAAKAGGRNQVIKDAAHAGE
AGEAELLDLAYMRLGWRKAYESGHSLIDSQHRDLFDLANNLLTSVIGDRPDDEVVPQVES
LVADLTKHFHDEEVIFRSVGYSSADDHAEIHRSLIIRANNLVENFKQGELSVGELFNYIA
YDFIAKHMLSEDRKFFGLIQADSMRQAES