Protein Info for AMB_RS04555 in Magnetospirillum magneticum AMB-1

Annotation: TRAP transporter small permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 93 to 116 (24 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details PF04290: DctQ" amino acids 20 to 173 (154 residues), 67.4 bits, see alignment E=5.8e-23

Best Hits

KEGG orthology group: K11689, C4-dicarboxylate transporter, DctQ subunit (inferred from 100% identity to mag:amb0894)

Predicted SEED Role

"TRAP-type transport system, small permease component, predicted N-acetylneuraminate transporter" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8X7 at UniProt or InterPro

Protein Sequence (232 amino acids)

>AMB_RS04555 TRAP transporter small permease (Magnetospirillum magneticum AMB-1)
MRALDHLEEWLIAFLMGTATLIIFVAVLQRYAAGTALLYPLVGHLDFSWAQELCIIMFVW
MAKFGAAYGVRTGIHVGVDVVINRLDPQWRAKLIVFGLLAGALFTGIVATMGGHFVMENG
AHYAFLHAFGLPTGDLYEGPITPDMEAPTWVVYSAIPLGSALMCFRFLQVCVGFIRTGEL
PHHDHGHVEGLEEDTTDPQRAAQDINWFEMSDNLHPKDAKDDKGDHQGEKRP