Protein Info for AMB_RS04550 in Magnetospirillum magneticum AMB-1

Annotation: C4-dicarboxylate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 6 to 35 (30 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 89 to 127 (39 residues), see Phobius details amino acids 137 to 161 (25 residues), see Phobius details amino acids 168 to 193 (26 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details amino acids 240 to 256 (17 residues), see Phobius details amino acids 268 to 292 (25 residues), see Phobius details amino acids 310 to 328 (19 residues), see Phobius details amino acids 335 to 352 (18 residues), see Phobius details amino acids 357 to 380 (24 residues), see Phobius details amino acids 392 to 414 (23 residues), see Phobius details PF06808: DctM" amino acids 7 to 415 (409 residues), 438.6 bits, see alignment E=1.1e-135 TIGR00786: TRAP transporter, DctM subunit" amino acids 17 to 421 (405 residues), 514.5 bits, see alignment E=9e-159

Best Hits

Swiss-Prot: 76% identical to DCTM_RHOCA: C4-dicarboxylate TRAP transporter large permease protein DctM (dctM) from Rhodobacter capsulatus

KEGG orthology group: K11690, C4-dicarboxylate transporter, DctM subunit (inferred from 100% identity to mag:amb0893)

Predicted SEED Role

"TRAP-type transport system, large permease component, predicted N-acetylneuraminate transporter" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8X8 at UniProt or InterPro

Protein Sequence (427 amino acids)

>AMB_RS04550 C4-dicarboxylate ABC transporter permease (Magnetospirillum magneticum AMB-1)
MNSAVIFGLLIVLMLTGMPISISLGLTVLSFLFLFTQVPIESVALKLFTGIEKFEIMAIP
FFILAGNFLTHGGVARRMINFATAMVGHWYGGLGLAGVMACALFAAVSGSSPATVVAIGS
IILPAMVKQGFPNKFGAGVITTSGALGILIPPSLVMVMYAVATNTSVGALFMAGVIPGLV
LATVLGAVTWYIAWKNDYPRLPPATWAQRFRAFREAIWGLALIVIVIGGIYTGVFTPTEA
AAMSAVYAFLIAVFVYKDMPLKGVGKILLSSASMSAMLLYIITNAVLFSFVLANENIPHA
IADWIVGKELGVIAFLLVVNVLLLVAGNFMEPSSIVLIMAPILFPVAMKLGIDPIHFGIL
IVVNMEVGMCHPPVGLNLYVASGITKMGITELTVAVWPWLLAMLGFLMVVTYWPPLSIWL
PRALGVM