Protein Info for AMB_RS04515 in Magnetospirillum magneticum AMB-1

Annotation: pyridoxine/pyridoxamine 5'-phosphate oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 TIGR00558: pyridoxamine 5'-phosphate oxidase" amino acids 6 to 195 (190 residues), 242.9 bits, see alignment E=1.4e-76 PF01243: PNPOx_N" amino acids 16 to 139 (124 residues), 100.4 bits, see alignment E=1.4e-32 PF12766: Pyridox_oxase_2" amino acids 22 to 96 (75 residues), 34.5 bits, see alignment E=4e-12 PF10590: PNP_phzG_C" amino acids 155 to 195 (41 residues), 61.3 bits, see alignment 1e-20

Best Hits

Swiss-Prot: 100% identical to PDXH_MAGSA: Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K00275, pyridoxamine 5'-phosphate oxidase [EC: 1.4.3.5] (inferred from 100% identity to mag:amb0886)

MetaCyc: 46% identical to pyridoxine/pyridoxamine 5'-phosphate oxidase (Escherichia coli K-12 substr. MG1655)
Pyridoxal 5'-phosphate synthase. [EC: 1.4.3.5]; 1.4.3.5 [EC: 1.4.3.5]

Predicted SEED Role

"Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.4.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.3.5

Use Curated BLAST to search for 1.4.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8Y5 at UniProt or InterPro

Protein Sequence (195 amino acids)

>AMB_RS04515 pyridoxine/pyridoxamine 5'-phosphate oxidase (Magnetospirillum magneticum AMB-1)
MSAPEADPLVLFHKWMDEAEKAEPNDPNAMALATADAEGRPSVRMVLLKGADQDGFVFFT
NLESRKGQELAANPHAALCLHWKSLRRQIRVEGSITRVSDEEADAYFATRARASQIGAWA
SIQSRPLTGRFELEKRVGEFAAKFGLGKVPRPPHWSGFRLAPRRIEFWHDRPFRLHDRFD
YVRDGDGWHLEHLYP