Protein Info for AMB_RS04510 in Magnetospirillum magneticum AMB-1

Annotation: ferrous iron transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 signal peptide" amino acids 1 to 11 (11 residues), see Phobius details transmembrane" amino acids 12 to 52 (41 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 150 to 168 (19 residues), see Phobius details amino acids 174 to 191 (18 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 6 to 276 (271 residues), 213 bits, see alignment E=2.8e-67 PF01545: Cation_efflux" amino acids 8 to 199 (192 residues), 132.4 bits, see alignment E=1.9e-42 PF16916: ZT_dimer" amino acids 203 to 280 (78 residues), 88.6 bits, see alignment E=2.5e-29

Best Hits

Swiss-Prot: 47% identical to FIEF_KLEPN: Cation-efflux pump FieF (fieF) from Klebsiella pneumoniae

KEGG orthology group: None (inferred from 100% identity to mag:amb0885)

MetaCyc: 45% identical to Zn2+/Fe2+/Cd2+ exporter (Escherichia coli K-12 substr. MG1655)
RXN0-6; TRANS-RXN0-200; TRANS-RXN0-244

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8Y6 at UniProt or InterPro

Protein Sequence (290 amino acids)

>AMB_RS04510 ferrous iron transporter (Magnetospirillum magneticum AMB-1)
MRLATYASTGTAALLIAVKLGAWLATGSVALLSTLIDSTLDLAASALNLMAVRHALVPAD
DEHRFGHGKAEALAGLGQAAFVVGSGGFLLAEAGSRMVHPQPVSHGEWGIAVMVFSIAAT
FALVGFQRMVAKRTGSLAISADSLHYTGDLLINASVIVSLLLAAGTGWPLADPLFAIGIA
GWLMINAWQIFRLSLDTLMDKELPEADRERIRAIVAAHPGVQDHHDLRTRTSGRQGFIQF
HLELPGNLPLVEAHRISDDVEKALLAEFPGFDVIIHEDPAGIRDARTEFR