Protein Info for AMB_RS04455 in Magnetospirillum magneticum AMB-1

Annotation: energy-dependent translational throttle protein EttA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 559 TIGR03719: ATP-binding cassette protein, ChvD family" amino acids 5 to 557 (553 residues), 962.1 bits, see alignment E=8.7e-294 PF00005: ABC_tran" amino acids 25 to 195 (171 residues), 84.1 bits, see alignment E=2.9e-27 amino acids 344 to 477 (134 residues), 94 bits, see alignment E=2.5e-30 PF12848: ABC_tran_Xtn" amino acids 234 to 305 (72 residues), 48 bits, see alignment E=2.2e-16

Best Hits

Swiss-Prot: 61% identical to ETTA_HAEIN: Energy-dependent translational throttle protein EttA (ettA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to mag:amb0875)

Predicted SEED Role

"ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W8Z6 at UniProt or InterPro

Protein Sequence (559 amino acids)

>AMB_RS04455 energy-dependent translational throttle protein EttA (Magnetospirillum magneticum AMB-1)
MASYQYVYVMKNLTKAYPGGKEIMKGLTLSFLPGAKIGVLGVNGAGKSTLLKIMAGIDKE
YGGEAWAAEGVKIGYLAQEPHLDPAKDVMGNVMEAVAETKALLDRFEEVSAKFAEELSDD
EMNDLIAEQGELQEKIDHLNAWDLTRTIEIAMDALRCPPGDADVTTLSGGERRRIALCRL
LLSHPDMLLLDEPTNHLDAESVAWLERFLEDYSGTVVMITHDRYFLDNVTGWILELERGH
GIPYEGNYTSWLEQKGKRLEQEEREETARMRAIRDELEWVRSSPKARQTKSKARISAFED
LVAKSQEKATGPAVISIPPGPRLGGKVIEAENVSKAFGDNLLYENLNFRLPPGGIVGIIG
PNGAGKTTLFRMITGQEQPTTGSFTVGETVVLGYVDQSRDSLDPDKTAFEEISDGQEEID
LGKRKINARAYAGLFNFKGADQQKKVGVLSGGERNRVHLAKMLSRPANVILLDEPTNDLD
VETLSALEDALAEFPGCAVVISHDRFFLDRIATHILAFEGDSQVVWFEGNYQDYEADRHR
RLGTDADQPHRIKYKPLKR