Protein Info for AMB_RS04385 in Magnetospirillum magneticum AMB-1

Annotation: elongation factor 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 604 PF00005: ABC_tran" amino acids 24 to 150 (127 residues), 77.2 bits, see alignment E=9e-25 amino acids 305 to 439 (135 residues), 80.3 bits, see alignment E=9.8e-26 PF16326: ABC_tran_CTD" amino acids 527 to 595 (69 residues), 76.7 bits, see alignment E=5.9e-25

Best Hits

Swiss-Prot: 52% identical to HFAC_CAUVC: Holdfast attachment protein C (hfaC) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: None (inferred from 100% identity to mag:amb0861)

Predicted SEED Role

"COG0488: ATPase components of ABC transporters with duplicated ATPase domains" in subsystem Folate Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W910 at UniProt or InterPro

Protein Sequence (604 amino acids)

>AMB_RS04385 elongation factor 3 (Magnetospirillum magneticum AMB-1)
MAPPPLLALRDVRLTFGGTPLFEGVTTWVAKGDKTCLVGRNGSGKSTLLKVLAGEILPDS
GERFVQPGASIAVLPQDPIILAPTIADYVAQGLPPAERDQMYRVDAVLDAVGIDGARDPV
ALSGGEGRRAALARALVGQPDALLLDEPTNHLDLPTILWLEEWLSSYGGALVMISHDRRF
LETVSKQTLWLERGVVRRAEFGFEKFPAWQDEVFAAEEAELARMNTRMRQEMHWLARGVT
ARRKRNMGRLRALQGLRSERAERKSQVLAAGRQVNLATDSGDLSGRLVIEAENVTKAFGD
KRICQDFSTRILRGDRVGLIGPNGAGKTTLLRMLTGELAPDGGVVRLGTNLETAYFDQRR
AALDPDKSVWDTLTDGRGDNVWVRGTPQHVVGYMKDFLFSEAQARTPVRALSGGERNRLL
LAKLLAKPSNLLILDEPTNDLDMETLDLLEEVLADYDGTLLVVSHDRDFLDRLVTSVIAV
EGDAEVSEYVGGYSDYLRQRPAKPANAAPKPPSKPQAQPKPQSARTRLSYNEQRELDQLP
SRIDKLTAEIAKLETDLADPALYAKDAARFQTLAARAEAARAELDDAEVRWLELEAKREE
AGGK