Protein Info for AMB_RS04340 in Magnetospirillum magneticum AMB-1

Annotation: enoyl-CoA hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 PF00378: ECH_1" amino acids 13 to 259 (247 residues), 193.5 bits, see alignment E=4.1e-61 PF16113: ECH_2" amino acids 17 to 191 (175 residues), 88.8 bits, see alignment E=5.1e-29

Best Hits

Swiss-Prot: 49% identical to ECHD3_RAT: Enoyl-CoA hydratase domain-containing protein 3, mitochondrial (Echdc3) from Rattus norvegicus

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 100% identity to mag:amb0852)

Predicted SEED Role

"Enoyl-CoA hydratase (EC 4.2.1.17)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Isoleucine degradation or Polyhydroxybutyrate metabolism or Valine degradation or n-Phenylalkanoic acid degradation (EC 4.2.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W919 at UniProt or InterPro

Protein Sequence (261 amino acids)

>AMB_RS04340 enoyl-CoA hydratase (Magnetospirillum magneticum AMB-1)
MSELETILLRRDEAGVATLTLNRPEARNALSVALMSELDSELARIARDPAVRVVVLAANG
PAFCAGHDLKEMRALQGRDEVAAVFALCSRVMTAIVRLPQPVIAKVHAMATAAGCQLVAS
CDLAYAATEAKFATPGVNIGLFCSTPMVALSRGVGRKQAMEMLLSGRPINAGTAERWGLV
NHVVAAEALDSEVASMARLIASKSAHTLKVGKEAFYRQLEMGLDDAYALASKVMTENMLA
MDAAEGIDAFLEKRPPVWRGC