Protein Info for AMB_RS04280 in Magnetospirillum magneticum AMB-1

Annotation: polyhydroxyalkanoate synthesis repressor PhaR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 PF07879: PHB_acc_N" amino acids 13 to 73 (61 residues), 107.8 bits, see alignment E=2.4e-35 TIGR01848: polyhydroxyalkanoate synthesis repressor PhaR" amino acids 14 to 118 (105 residues), 146.9 bits, see alignment E=1.3e-47 PF05233: PHB_acc" amino acids 78 to 117 (40 residues), 58 bits, see alignment 7.5e-20

Best Hits

KEGG orthology group: None (inferred from 65% identity to rru:Rru_A0276)

Predicted SEED Role

"PhbF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (187 amino acids)

>AMB_RS04280 polyhydroxyalkanoate synthesis repressor PhaR (Magnetospirillum magneticum AMB-1)
MSESQTSAKAPITIKKYANRRLYNTATSSYVTLDHLSQMVKDGDDFVVYDAKTGEDITRS
VLTQIIVEEESKGGQNLLPISFLRQLIGFYGDSLGGLVPRYLEYSMQAFSHNEAQMRDYM
RNALEGMFPFGPFEEMGKKNMAFMESAMKMFSPFYPQGADGSSPKVEDLQASVSALQKQI
DQLTKKK