Protein Info for AMB_RS04260 in Magnetospirillum magneticum AMB-1

Annotation: signal peptidase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 51 to 61 (11 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 102 to 120 (19 residues), see Phobius details amino acids 140 to 164 (25 residues), see Phobius details PF01252: Peptidase_A8" amino acids 13 to 164 (152 residues), 132.5 bits, see alignment E=6.6e-43 TIGR00077: signal peptidase II" amino acids 15 to 169 (155 residues), 109.9 bits, see alignment E=5.8e-36

Best Hits

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 100% identity to mag:amb0835)

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W936 at UniProt or InterPro

Protein Sequence (172 amino acids)

>AMB_RS04260 signal peptidase II (Magnetospirillum magneticum AMB-1)
MLLSNSLPRGLSIAGLIIFLDQLSKYWVVERIMRPEGVDGTPFYSATRIELLPFFDVVMA
WNRGVSFGIGNNGGEWNALILSALAMVICAGMTFWLAKAETFLVQVALGGIIGGALGNVI
DRARFGAVADFLDLHVAGYHWPAFNVADSAITVGAVFLVVDSLFAGRDSSKN