Protein Info for AMB_RS04205 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain-containing sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 795 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 265 to 286 (22 residues), see Phobius details PF02743: dCache_1" amino acids 31 to 243 (213 residues), 51.3 bits, see alignment E=5.6e-17 PF22588: dCache_1_like" amino acids 187 to 251 (65 residues), 49.7 bits, see alignment E=1.6e-16 TIGR00229: PAS domain S-box protein" amino acids 303 to 427 (125 residues), 69.3 bits, see alignment E=1.7e-23 amino acids 430 to 551 (122 residues), 42.7 bits, see alignment E=2.9e-15 PF08448: PAS_4" amino acids 314 to 423 (110 residues), 35 bits, see alignment E=6.8e-12 PF13426: PAS_9" amino acids 325 to 420 (96 residues), 29 bits, see alignment E=5e-10 amino acids 448 to 543 (96 residues), 27.9 bits, see alignment E=1.1e-09 PF00989: PAS" amino acids 325 to 418 (94 residues), 30.7 bits, see alignment E=1.2e-10 PF08447: PAS_3" amino acids 330 to 410 (81 residues), 35.1 bits, see alignment E=5.7e-12 PF00512: HisKA" amino acids 565 to 631 (67 residues), 43.1 bits, see alignment E=1.6e-14 PF02518: HATPase_c" amino acids 676 to 785 (110 residues), 96.4 bits, see alignment E=6.8e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0823)

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-); Cyanobacterial phytochrome B" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W948 at UniProt or InterPro

Protein Sequence (795 amino acids)

>AMB_RS04205 PAS domain-containing sensor histidine kinase (Magnetospirillum magneticum AMB-1)
MTAVLLVVWISGILVAWRDRNNSLNDSGRLTEALTRVVAERISGSLRGLDLMLQDVDIHS
RERSDPTELLNLMRHRSAGLPEVRNVFIINADGKVTSSTLPSMLGLDLSRRPYFMTAAQT
PIHGHLIITPPSVSPVTGKLGLVVARPITSPVGTFAGLIAVALNPEFFSGALSGVVEGDV
DRAVVANMDGNVLARLPDPGLHVGSSIRSGPLFSDYLPKARAGTFIAPSSFDGQDRLASY
QALNHQPIVVSVGITTQAALRRWTVNTLVMAGIGLLFSTVLLGAALQLERRERERRGAET
ALKASEESYRILVDDQDDLIHRYTQDTTLITVNRAYARFYGQTPDSLIGRKWIEFLPDEE
RTFSLSCLQALNHIQPYREDRRRVVRPDGQELWIEWRTTALYDALDNLTGYQTVGRDVTD
SHRAQQAISEREELYSQSFHRNPAIKLLIDPKSGAITDANDSAALFYGYPADVLKHMNIQ
DINVASAAEIEHEMAAVENEGRKFLRFRHRLSSGDIRDVEVYSSPLHVGGRAYLSSIVVD
VSDRNRFEAELQAKTAELARSNAELEQFAYVASHDLRQPLRMVTSYVTLLERHLGETLDE
SSREFIGYTISGVRRMDALIKGLLDYSRVGRGGETLSDLDLEEVVADSCANLGLTGSSDE
ATVLVEHPLPRILGISSELIRLFQNLIGNAVKYRHPERKPEIRLSSRRQGNEWIITVEDN
GLGIGAEHFERIFGMFQRLHAEGEFEGTGIGLAICRKIVTTHGGRIWVESEEGAGSRFMV
ALPASRAAARGLATH