Protein Info for AMB_RS04115 in Magnetospirillum magneticum AMB-1

Annotation: 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 TIGR02299: 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase" amino acids 2 to 484 (483 residues), 706.8 bits, see alignment E=6.4e-217 PF00171: Aldedh" amino acids 13 to 471 (459 residues), 571.7 bits, see alignment E=5.1e-176

Best Hits

Swiss-Prot: 62% identical to HPCC_ECOLX: 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase (hpcC) from Escherichia coli

KEGG orthology group: None (inferred from 100% identity to mag:amb0805)

MetaCyc: 63% identical to subunit of 5-carboxymethyl-2-hydroxymuconic semialdehyde dehydrogenase (Escherichia coli B)
5-carboxymethyl-2-hydroxymuconic-semialdehyde dehydrogenase. [EC: 1.2.1.60]

Predicted SEED Role

"5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase (EC 1.2.1.60)" in subsystem 4-Hydroxyphenylacetic acid catabolic pathway or Aromatic amino acid degradation or Central meta-cleavage pathway of aromatic compound degradation (EC 1.2.1.60)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.60

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W966 at UniProt or InterPro

Protein Sequence (485 amino acids)

>AMB_RS04115 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase (Magnetospirillum magneticum AMB-1)
MIKHLINGRQVESASTIANLNPANNEVICQIAAGGEAEVAQAVAAAKEAFPKWAGLPASQ
RAKLLRKVGDLINQHVDEIAKLESLDTGQSYWRTKKMLVPRAADNFYFFADTCCHVDGET
YPTNDHLNYTLYQPVGVVGLISPWNVPFMTATWKTAPCLAFGNTAVLKMSELSPLSADRL
GQLILEAGIPAGVFNIVHGYGSAVGEALVKHPDVRGVSFTGSTATGNRIIQSGGLKKYSM
ELGGKSPNIIFDDCDFERAVDAAIVAVYGNNGESCTNGTRILVQDGLYDRFVAALAERTR
KVVVGDPLDEATNVGPMITRDHWKKVTSYIELGISEGARVVAGGLGTPEGLAPHLKNGNF
VRPTVLADVDNSWRVAQEEIFGPVACVIRFKDEAEALKIANATSYGLASYVWTENGARAI
RMAEGIEAGLVFVNSQNVRDLRQPFGGIKGSGTGREGGHYSYEAFLEVKNVCVSKGSHHI
PRWGV