Protein Info for AMB_RS04090 in Magnetospirillum magneticum AMB-1

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 55 to 80 (26 residues), see Phobius details amino acids 88 to 111 (24 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 173 to 199 (27 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 293 to 314 (22 residues), see Phobius details amino acids 320 to 342 (23 residues), see Phobius details amino acids 354 to 376 (23 residues), see Phobius details amino acids 380 to 380 (1 residues), see Phobius details amino acids 382 to 403 (22 residues), see Phobius details PF05977: MFS_3" amino acids 14 to 403 (390 residues), 171.9 bits, see alignment E=2e-54 PF07690: MFS_1" amino acids 27 to 369 (343 residues), 94.3 bits, see alignment E=7.2e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0800)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W971 at UniProt or InterPro

Protein Sequence (412 amino acids)

>AMB_RS04090 MFS transporter (Magnetospirillum magneticum AMB-1)
MTGKVRLNAPRHKAFAALGAPRFRRFFAGQALSILGTWVQSVAMSWLVYRLTGSAVLLGV
TAFLSQAPQLVISPLAGLFIDRFDRRRLFLCVQALMIAQAALLAAITALGVVTPAHLVGL
AALFGVLNSVDTPLRQSMLGGMVEDRALLRNAIALNASLFNSARFVGPPLAGLILSFTSE
SWCFAINAASFLGVAFAVWRQPPQPPSGASGGMAEAFRQGLAFAWNNQTIRTLLFSVAAL
NLAGSAYGVLMPILAKEGFAGDASTLGWLLGATGGGALAATLLVATRQRLEQLLRLVIMG
WGCAALGLGGLGLSPSLTPALAAAFCIGLGISSVNVSTNALLQSMAPDAIRGRVISYFTA
LRFGMDALGGLAAGAMAAGLGVAGTLGLEAGLVAAGALAMATLSRRIKATEA