Protein Info for AMB_RS04085 in Magnetospirillum magneticum AMB-1

Annotation: GDP-L-fucose synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 PF04321: RmlD_sub_bind" amino acids 12 to 128 (117 residues), 32.8 bits, see alignment E=8e-12 PF01370: Epimerase" amino acids 13 to 243 (231 residues), 207.9 bits, see alignment E=3.3e-65 PF02719: Polysacc_synt_2" amino acids 24 to 112 (89 residues), 21.9 bits, see alignment E=1.8e-08 PF16363: GDP_Man_Dehyd" amino acids 42 to 303 (262 residues), 62.2 bits, see alignment E=1.2e-20

Best Hits

Swiss-Prot: 55% identical to FCL_SINFN: GDP-L-fucose synthase (fcl) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 100% identity to mag:amb0799)

MetaCyc: 55% identical to GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase (Arabidopsis thaliana col)
GDP-L-fucose synthase. [EC: 1.1.1.271]

Predicted SEED Role

"GDP-L-fucose synthetase (EC 1.1.1.271)" in subsystem Capsular heptose biosynthesis or Colanic acid biosynthesis (EC 1.1.1.271)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.271

Use Curated BLAST to search for 1.1.1.271

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W972 at UniProt or InterPro

Protein Sequence (315 amino acids)

>AMB_RS04085 GDP-L-fucose synthase (Magnetospirillum magneticum AMB-1)
MAGANFSLAGKRVFVAGHRGMAGSAILRRLQSEDCETLTVDRLALDLRNQSAVEAWMEDK
RPDAVFLAAALVGGIRANSTRPAEFLYDNLAVEMNVIHAAHRVGVSRLLFLGSSCAYPRE
AAQPMAESSMLTGPLEPTNEAYAIAKIAGIKLCEAYHRQYGRHFMSAVPASLIGPGDRFD
AENGHVGAALVMKFHDAVQRGADTVELWGTGSPIREFLYVDDLADACVFLMKSLGGGEII
NVGSGIEASIRELAELTARVVGFKGKLSFDTTKPDGMMRKLVDSTRIRAMGWQAATSLEE
SIRRGYEWYLANSKA