Protein Info for AMB_RS04040 in Magnetospirillum magneticum AMB-1

Annotation: phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 PF00702: Hydrolase" amino acids 6 to 179 (174 residues), 91.5 bits, see alignment E=1.8e-29 PF13419: HAD_2" amino acids 8 to 187 (180 residues), 108.7 bits, see alignment E=7.5e-35 PF12710: HAD" amino acids 9 to 138 (130 residues), 30.2 bits, see alignment E=1.2e-10 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 77 to 187 (111 residues), 60.5 bits, see alignment E=2.2e-20 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 103 to 182 (80 residues), 28.1 bits, see alignment E=2.4e-10

Best Hits

Swiss-Prot: 42% identical to CBBY_RHOSH: Protein CbbY (cbbY) from Rhodobacter sphaeroides

KEGG orthology group: None (inferred from 100% identity to mag:amb0790)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W981 at UniProt or InterPro

Protein Sequence (221 amino acids)

>AMB_RS04040 phosphatase (Magnetospirillum magneticum AMB-1)
MMNQVAALIFDVDGTLAETEEAHRYAFNRAFSEAGLNWTWNQETYRKLLKVSGGKERILA
FAPDASPELVAGLHNRKNQIYTKMVDSGQVSFRPGVESLISSARAQGLKLAVATTATRAN
VETLLGARKAFFHTIACAEDVRRKKPDPEVYALVLKRLDLPADKCLVLEDSVNGVTAATT
IGLKVVVTPSLYTKGQDFSAAAAVLKDLSGITLAKLIELKG