Protein Info for AMB_RS04000 in Magnetospirillum magneticum AMB-1

Annotation: XRE family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 PF13560: HTH_31" amino acids 23 to 77 (55 residues), 32.7 bits, see alignment E=8e-12 PF01381: HTH_3" amino acids 27 to 80 (54 residues), 55 bits, see alignment E=6.9e-19

Best Hits

Swiss-Prot: 43% identical to Y497_RICPR: Uncharacterized HTH-type transcriptional regulator RP497 (RP497) from Rickettsia prowazekii (strain Madrid E)

KEGG orthology group: None (inferred from 100% identity to mag:amb0781)

Predicted SEED Role

"transcriptional regulator, Cro/CI family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W990 at UniProt or InterPro

Protein Sequence (130 amino acids)

>AMB_RS04000 XRE family transcriptional regulator (Magnetospirillum magneticum AMB-1)
MPTRAEAKPARPMNRANDTDRHVGSRIRERRIMLGLSQQQMADLIGVTYQQAHKYERGIN
RISAGRLFEIAQVLGVPVGFFYEGLENRRGSDLSARQRMCLELARNFTSITNERHQEALS
QLARALAAED