Protein Info for AMB_RS03990 in Magnetospirillum magneticum AMB-1

Annotation: NADPH-dependent 7-cyano-7-deazaguanine reductase QueF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 TIGR03139: 7-cyano-7-deazaguanine reductase" amino acids 22 to 131 (110 residues), 146.1 bits, see alignment E=1.9e-47 PF14489: QueF" amino acids 57 to 133 (77 residues), 108.9 bits, see alignment E=6.2e-36

Best Hits

Swiss-Prot: 100% identical to QUEF_MAGSA: NADPH-dependent 7-cyano-7-deazaguanine reductase (queF) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K09457, 7-cyano-7-deazaguanine reductase [EC: 1.7.1.13] (inferred from 100% identity to mag:amb0779)

Predicted SEED Role

"NADPH dependent preQ0 reductase (EC 1.7.1.13)" (EC 1.7.1.13)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W992 at UniProt or InterPro

Protein Sequence (153 amino acids)

>AMB_RS03990 NADPH-dependent 7-cyano-7-deazaguanine reductase QueF (Magnetospirillum magneticum AMB-1)
MGTGTEHLTQLGQSTALPASPDKAVLETVPNPHPGTLYLVRFTAPEFTSLCPITGQPDFA
QLVIDYAPEGSLVESKSLKLFLGSFRNHGAFHEDCTIAIAKRLVAACAPKWLRIGGYWYP
RGGIPIDVFWQTGPAPEGLWLPDQGVAGYRGRG