Protein Info for AMB_RS03965 in Magnetospirillum magneticum AMB-1

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 transmembrane" amino acids 46 to 64 (19 residues), see Phobius details PF00005: ABC_tran" amino acids 20 to 161 (142 residues), 110.5 bits, see alignment E=1e-35

Best Hits

KEGG orthology group: K01990, ABC-2 type transport system ATP-binding protein (inferred from 70% identity to rce:RC1_2540)

Predicted SEED Role

"InterPro IPR001687:IPR003439:IPR003593 COGs COG1131"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>AMB_RS03965 ABC transporter ATP-binding protein (Magnetospirillum magneticum AMB-1)
MSAIEVQALFKSFGPVKAVDGISFSIAAGSTTALLGGNGAGKTTTLSVLLGLLLPTSGSI
TVLGEDMVRHRYRVLPRMNFSSPYVDLPHRLTVRQNLRVYGGLYGVARLKDRIAELCDEL
ELGDFIDRPAGKLSAGQKTRVALAKALLNKPDLLLLDEPTASLDPDTADWVRSYFQAYRQ
RAGATIVLASHNMTEVERMCDHVLMMKQGRIVDQGSPAALIERFGRASMEEVFLDIARDR
QRPETAS