Protein Info for AMB_RS03915 in Magnetospirillum magneticum AMB-1

Annotation: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR00216: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase" amino acids 12 to 291 (280 residues), 312.7 bits, see alignment E=1e-97 PF02401: LYTB" amino acids 13 to 289 (277 residues), 316.3 bits, see alignment E=8.1e-99

Best Hits

Swiss-Prot: 66% identical to ISPH_ROSDO: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (ispH) from Roseobacter denitrificans (strain ATCC 33942 / OCh 114)

KEGG orthology group: K03527, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [EC: 1.17.1.2] (inferred from 100% identity to mag:amb0764)

MetaCyc: 55% identical to 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (Escherichia coli K-12 substr. MG1655)
RXN-24043 [EC: 1.17.7.4]; 1.17.7.4 [EC: 1.17.7.4]

Predicted SEED Role

"4-hydroxy-3-methylbut-2-enyl diphosphate reductase (EC 1.17.1.2)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 1.17.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.2 or 1.17.7.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9A7 at UniProt or InterPro

Protein Sequence (318 amino acids)

>AMB_RS03915 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (Magnetospirillum magneticum AMB-1)
MSTSVTKRPLTLVLASPRGFCAGVDRAIHIVERALEKYGAPVYVRHEIVHNRFVVESLAQ
KGAVFVEELNEVPDEAAVVFSAHGVPKTVPAEADRRGLTSLDATCPLVTKVHREAELHHA
MGRQIIMIGHAGHPEVIGTIGQVPEGTVLLVGTPEQAETVAPRDPSMLAYITQTTLSVDD
AAAVIDVLQRRFPDMVGPKREDICYATTNRQAAVKTIAPHCEALMVIGSPNSSNSSRLVE
VAARAGCARSVLVQRAAEVDWSLLDGVDRLGITAGASAPEILVEEVVAAARERFDVTIEE
IRVTTETVTFKLPQALSE