Protein Info for AMB_RS03860 in Magnetospirillum magneticum AMB-1

Annotation: NADPH:quinone oxidoreductase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 PF08240: ADH_N" amino acids 25 to 108 (84 residues), 56.2 bits, see alignment E=5.6e-19 PF00107: ADH_zinc_N" amino acids 149 to 273 (125 residues), 101.6 bits, see alignment E=4.8e-33 PF13602: ADH_zinc_N_2" amino acids 182 to 320 (139 residues), 80.5 bits, see alignment E=3.3e-26

Best Hits

Swiss-Prot: 47% identical to QORL2_NEMVE: Quinone oxidoreductase-like protein 2 homolog (v1g238856) from Nematostella vectensis

KEGG orthology group: K00344, NADPH2:quinone reductase [EC: 1.6.5.5] (inferred from 100% identity to mag:amb0752)

Predicted SEED Role

"Quinone oxidoreductase (EC 1.6.5.5)" in subsystem ZZ gjo need homes (EC 1.6.5.5)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.5

Use Curated BLAST to search for 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9B9 at UniProt or InterPro

Protein Sequence (323 amino acids)

>AMB_RS03860 NADPH:quinone oxidoreductase family protein (Magnetospirillum magneticum AMB-1)
MKAVVCPAFGQDLVVTDFPAPAMIPGGVRIAVHAAGVNFADSLITGGKYQEKMEPPFVPG
MELAGVVTEVADGVTTAKPGDRVMATVTGGAFAEEAVCDQTDVYVLPDGLDFVTAAGFPV
AYGTSHLGLKGKAGLKSGETLVVHGAAGGVGLTAVEVGRALGATVIGTAGGPDKVKVALE
HGAHFGIDYKAEDIRERVKALTDGRGADVVYDPVGGQVFDASLRSIAADGRILIIGFAGG
TVQQIPANILLVKNVTVIGYYWGAYRKIAPQMVRDSLGECLDWWAAGKLSPHVSKVMDLS
QAVEAIGLLKGRAATGKIVLICR