Protein Info for AMB_RS03740 in Magnetospirillum magneticum AMB-1

Annotation: signal transduction protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 679 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 180 to 202 (23 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 262 to 426 (165 residues), 174.5 bits, see alignment E=7.6e-56 PF00990: GGDEF" amino acids 267 to 423 (157 residues), 154.8 bits, see alignment E=1.7e-49 PF00563: EAL" amino acids 443 to 673 (231 residues), 201.8 bits, see alignment E=1.1e-63

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0729)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9E2 at UniProt or InterPro

Protein Sequence (679 amino acids)

>AMB_RS03740 signal transduction protein (Magnetospirillum magneticum AMB-1)
MDDLKFKARISITRVVFLLSLTATVLALGVVVLISGHVREKSVNDLARDEARQTSTLVFE
TLYAAMRKGWSKDEIGEVITRLQVALPDLSIHVIRGRPVIEQFGEIANDVAIVRHDPLLQ
EVLASGKETLLPSPTGIRYLYPLIVREECLACHTAAKVGDINGVIDIVYPVHALKVSLDY
VLNTVLAYFFAILLLLSAALYFKLKVFVARPITNMVALMQEIILHTDLSRRVETKGIIAE
VADLSDYFNKLLRTVEEYQHRLEDLSIRDPLTRLYNRRKFDEFLDHEIDRAQRHGHPFCV
AQIDLDDFKNINDTFGHPIGDLVLKELASVLYREVRRTDVVARVGADEFAVLLPETTMEE
GVAAAEKLRQAVADCQLGLPVGGVRITASIGLVGYPDNADDAQKLAIAADVAIYKAKRSG
KNQVAVIGEGEDATVAIFSQGEMVRSALAEGRLVPFFQPIVAAEDGSVAAYEVLARVVDG
DQAVCAGDFIESAEELGLAGEIDAAVFDGALEAMAAGKLGDAKIFVNLSAKSLTDRERMM
AIPERLHAAGVSPSRVVLEITEREALPHFGDIVAMINELRSTGLGFALDDFGSGFSSFLY
LKYITVDYVKIEGSFIRHVVTDERDRIMVEHIHSMARRFGMITIAEFVEDEDTMVLLRKM
GINLCQGFHIAVPKPIHKL