Protein Info for AMB_RS03635 in Magnetospirillum magneticum AMB-1

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 758 PF13432: TPR_16" amino acids 76 to 127 (52 residues), 34.3 bits, see alignment 2.6e-11 amino acids 119 to 163 (45 residues), 20.9 bits, see alignment 4e-07 amino acids 176 to 234 (59 residues), 18.7 bits, see alignment 1.9e-06 amino acids 307 to 370 (64 residues), 37.8 bits, see alignment E=2e-12 amino acids 342 to 402 (61 residues), 27.5 bits, see alignment 3.5e-09 amino acids 410 to 456 (47 residues), 18.3 bits, see alignment 2.7e-06 PF07719: TPR_2" amino acids 98 to 128 (31 residues), 23 bits, see alignment (E = 6.2e-08) amino acids 337 to 369 (33 residues), 31.5 bits, see alignment (E = 1.1e-10) PF13181: TPR_8" amino acids 99 to 129 (31 residues), 12.9 bits, see alignment (E = 0.00011) amino acids 133 to 164 (32 residues), 12 bits, see alignment (E = 0.00021) amino acids 337 to 369 (33 residues), 25.8 bits, see alignment (E = 7.6e-09) PF13374: TPR_10" amino acids 103 to 127 (25 residues), 15.1 bits, see alignment (E = 1.9e-05) amino acids 407 to 429 (23 residues), 15.8 bits, see alignment (E = 1.1e-05) PF13176: TPR_7" amino acids 134 to 163 (30 residues), 14.2 bits, see alignment (E = 4e-05) amino acids 168 to 199 (32 residues), 15.1 bits, see alignment (E = 2e-05) amino acids 339 to 370 (32 residues), 16.8 bits, see alignment (E = 5.8e-06) PF07721: TPR_4" amino acids 167 to 189 (23 residues), 10.3 bits, see alignment (E = 0.0011) amino acids 407 to 428 (22 residues), 14.8 bits, see alignment (E = 3.7e-05) PF14559: TPR_19" amino acids 316 to 371 (56 residues), 25.6 bits, see alignment 1.2e-08 PF00515: TPR_1" amino acids 337 to 369 (33 residues), 32.2 bits, see alignment (E = 6.6e-11) PF13414: TPR_11" amino acids 343 to 384 (42 residues), 29.4 bits, see alignment 5e-10 PF01075: Glyco_transf_9" amino acids 666 to 702 (37 residues), 29.4 bits, see alignment 5.3e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0708)

Predicted SEED Role

"FOG: TPR repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9G3 at UniProt or InterPro

Protein Sequence (758 amino acids)

>AMB_RS03635 tetratricopeptide repeat protein (Magnetospirillum magneticum AMB-1)
MAIDAGSWHLASPVLSMPSFAQNNCGETILAEDFAKAVELHQAGRLLEAVEIYQRILVAN
PYDEGANHLLGVACSQMGQFDLAIHLIGEAIRANDRVPDYHVNLGNALFSSRRLPEAEAA
YRRALTLNTDIPEALFGLGNTLAQTGRLEESLEFHQSALALRPNFVEALANMAGVLSRLG
RPAEAVEKLRRAVAERPGEASLQADLGRALLASGHRIEADVAVCRALRLAPDSPPILVAA
ADVIRARGRMEEALEHAARAAELAPNYPPAVLMLARQLRAMGRRDLSAETYLRLAGIEGA
GVAHLFDAANALNEMSRLPEAVALYQALLAREHDHSEVWNNLGNALRELGELDRAAECYE
TAERLSPDDPVVMSNRAALLGSLGRVAEAEILCRKVVALQPGIGIPLSNLGQALYAQGRM
EEAREQFDAAGAADSTNDDIRFHRAIVRLMLGDFAEGWPLYEARWGNRKRAEPNRHFATP
QWLGDEDLAGKTLLLWSEQGFGDTLQFVRFAPLATARGARVILEVQPALVSLLRGMPGIA
QVVAVGDDTGPVDLQSPLMSLPMAFGITLESIPAAVPYLAPPPERLEPWTRRLNASLPPG
PRIGLVWAGDSREHDIECTLIDRRRSLALKQLEPILAVEEASFVSLQVGKQGLQARDEPR
VADLTAGITDFADTAALISGLDLVISVDTSTAHLAAALGKPVWLLSRFDGCWRWLQGRDD
SPWYPTLRLYRQPAAGDWDTPLAKMATDLREWLKTIRR