Protein Info for AMB_RS03285 in Magnetospirillum magneticum AMB-1

Annotation: DNA replication and repair protein RecF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 PF02463: SMC_N" amino acids 17 to 359 (343 residues), 69.3 bits, see alignment E=5.1e-23 TIGR00611: DNA replication and repair protein RecF" amino acids 17 to 365 (349 residues), 159.9 bits, see alignment E=4.8e-51 PF13476: AAA_23" amino acids 19 to 63 (45 residues), 32.5 bits, see alignment 2.1e-11 PF13304: AAA_21" amino acids 41 to 60 (20 residues), 27.9 bits, see alignment (E = 3.4e-10)

Best Hits

KEGG orthology group: K03629, DNA replication and repair protein RecF (inferred from 100% identity to mag:amb0638)

Predicted SEED Role

"DNA recombination and repair protein RecF" in subsystem DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9N3 at UniProt or InterPro

Protein Sequence (394 amino acids)

>AMB_RS03285 DNA replication and repair protein RecF (Magnetospirillum magneticum AMB-1)
MIGDRVAQAEPVARPAVRRLTLADFRCYRTLRLETDSRPVVLTGANGAGKTNILEALSFL
VPGRGLRRAGAADITRHGLAAGSPWAVAATLDGPAGRVEIGTGREAGHERRSVRIDGKPA
KPGDLAGLVSALWLTPAMDRLFIEGASGRRRFLDRLVFGLVPGHGAEAGAYEHAMRERTR
LLRAARDGGPRVDPAWMAALEEGMARHGTRVALARVESIRRLDEACRAGLGPFPAAGLAV
EGEIEGWLAGGLSPDEAEERFRGALRVARARDEAAGAATMGPHRSDLMVRHVPKDLPAGQ
CSTGEQKAVLVSIVLAQGRVQDQSGGRAPLLLLDEVAAHLDEVRRAALFDELCALKAQSW
MTGTDAMLFAGFGERAQFFRVTDATVAPEEVMTL