Protein Info for AMB_RS03215 in Magnetospirillum magneticum AMB-1

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF12146: Hydrolase_4" amino acids 61 to 329 (269 residues), 73.3 bits, see alignment E=7e-24 PF00561: Abhydrolase_1" amino acids 64 to 328 (265 residues), 70.6 bits, see alignment E=6e-23 PF12697: Abhydrolase_6" amino acids 65 to 326 (262 residues), 65.5 bits, see alignment E=4e-21 PF02129: Peptidase_S15" amino acids 86 to 323 (238 residues), 28.8 bits, see alignment E=3.6e-10 PF00326: Peptidase_S9" amino acids 227 to 342 (116 residues), 24.4 bits, see alignment E=6.8e-09 PF08386: Abhydrolase_4" amino acids 275 to 344 (70 residues), 22.1 bits, see alignment E=4.8e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0624)

Predicted SEED Role

"InterPro IPR000073:IPR000379:IPR000734:IPR002410 COGs COG0596"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9P7 at UniProt or InterPro

Protein Sequence (348 amino acids)

>AMB_RS03215 alpha/beta hydrolase (Magnetospirillum magneticum AMB-1)
MMMAILGRGWGVAIAALVLMAAALPAGAETVTEEFKIASKWPDQNLYIRNKHPAALYDVR
PEKTVLFLHGATYPAHSSFDMAVDGQSWMDWMAAKGYDVYSLDIRGYGKSGHPPEMSQPP
EANPPVVDTAEAVDDVSRAVDFILSRRNSQRIVLVGWSWGATLAGAYANSSQDKVERLVL
YAPQWLRDVTPPTDAELARVPAWRQVDPREARDIWLKAVPEAKREGVLSKAVFADWLKAT
IASDAEPVVPNTVRAPNGVVLDTMRFWASAKPRWNPERLSVPALVIQGEWDAEAPPAMGM
KLFNRLTGSPFKRYVMVGEATHAALIEKNRKQLYQAVTEFLESPAPQR