Protein Info for AMB_RS03165 in Magnetospirillum magneticum AMB-1

Annotation: flagellar basal body rod protein FlgB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 TIGR01396: flagellar basal-body rod protein FlgB" amino acids 8 to 128 (121 residues), 60 bits, see alignment E=1.3e-20 PF00460: Flg_bb_rod" amino acids 19 to 37 (19 residues), 30.7 bits, see alignment 1.2e-11

Best Hits

KEGG orthology group: K02387, flagellar basal-body rod protein FlgB (inferred from 100% identity to mag:amb0614)

Predicted SEED Role

"Flagellar basal-body rod protein FlgB" in subsystem Flagellum or Flagellum in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9Q7 at UniProt or InterPro

Protein Sequence (133 amino acids)

>AMB_RS03165 flagellar basal body rod protein FlgB (Magnetospirillum magneticum AMB-1)
MYDDLGIFKMAKAQMDWIAQRQEVLASNIANANTPRYLPKDIKPLDFKEVLAGTAQPDVG
ATTTNAKHIVPEVTPSPFKAVTQRRTFESTPDGNAVILEEQIAKVGDANSKYNAAAALFQ
KYQKMIKTASGSR