Protein Info for AMB_RS03110 in Magnetospirillum magneticum AMB-1

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 transmembrane" amino acids 41 to 61 (21 residues), see Phobius details PF13505: OMP_b-brl" amino acids 43 to 240 (198 residues), 59.7 bits, see alignment E=1e-19 PF01389: OmpA_membrane" amino acids 56 to 241 (186 residues), 28 bits, see alignment E=4.5e-10 PF02462: Opacity" amino acids 98 to 217 (120 residues), 30.5 bits, see alignment E=8.4e-11 PF00691: OmpA" amino acids 276 to 371 (96 residues), 66.5 bits, see alignment E=5.8e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0602)

Predicted SEED Role

"Outer membrane protein A precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9R9 at UniProt or InterPro

Protein Sequence (378 amino acids)

>AMB_RS03110 membrane protein (Magnetospirillum magneticum AMB-1)
MLRRGTVTLPDAGGERRYGGRFTTHRTPTGRFITMRSLKSLLAAAVVVGALAPVAAQAQW
YVGLDAGAQLLQDSKNSGSGVSGLKSESDVGWLTQGVVGYAFGQWRAEGELSYRSSGVSK
VGGATGSGDTSALAPMFNGVYEFLPQSKWHPFVGLGIGAARLDNGTVKKNGANAYSGDDW
QFAYQGFAGVGYDLTDNVELKAQYRYFSTLDYESKAASNNAKIDSEYRDHGLMLGFVYKF
NAPKAAPAPAPVPVAAPAPAPAPRAPAQVQKNYIVFFDFDKAQITPEAARVLQQAAGAAK
TAGAARIDLSAHTDLSGSAKYNQALSEKRGAAVKAQLEQLGIPASQIVVVAKGKTSPMVP
TPDGVREPQNRRVEIILP