Protein Info for AMB_RS03060 in Magnetospirillum magneticum AMB-1

Annotation: peptidoglycan editing factor PgeF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF02578: Cu-oxidase_4" amino acids 18 to 252 (235 residues), 250.9 bits, see alignment E=5.9e-79 TIGR00726: YfiH family protein" amino acids 28 to 252 (225 residues), 164.9 bits, see alignment E=9.3e-53

Best Hits

KEGG orthology group: K05810, conserved hypothetical protein (inferred from 100% identity to mag:amb0593)

Predicted SEED Role

"COG1496: Uncharacterized conserved protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9S8 at UniProt or InterPro

Protein Sequence (256 amino acids)

>AMB_RS03060 peptidoglycan editing factor PgeF (Magnetospirillum magneticum AMB-1)
MITLSALNEFVRIRHGFFTREGGVSEGLYASLNCGPGSSDKPEAVKENRRRVMAMLDLPE
EALVTLYQTHSSDVVKVTEPWDAAKAPKADAMVTDRPGIALGILTADCAPVLLADGKAGI
VAAAHAGWKGALGGVLDNTIKAMVEMGAKMPKIVAAMGPCIGHRNYEVGPEFPAPFLAED
PTNADYFAPSPARPGHFLFDLPGYISRKLAKLGVHEVTRVPADTLRDEARFFSYRRATLR
GEADYGRQISVITLDR