Protein Info for AMB_RS03045 in Magnetospirillum magneticum AMB-1
Annotation: hydrogen peroxide-inducible genes activator
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 40% identical to OXYR_HAEIN: Hydrogen peroxide-inducible genes activator (oxyR) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
KEGG orthology group: None (inferred from 100% identity to mag:amb0589)Predicted SEED Role
"Hydrogen peroxide-inducible genes activator" in subsystem DNA-binding regulatory proteins, strays or Oxidative stress or Thioredoxin-disulfide reductase
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2W9T2 at UniProt or InterPro
Protein Sequence (297 amino acids)
>AMB_RS03045 hydrogen peroxide-inducible genes activator (Magnetospirillum magneticum AMB-1) MATHLPTLRQLRYLVALAEHRHFGRAAEECFATQSTLSAGLQELESLLGATLVERTKRKV LMTPLGEEVVTRARDLLRAAEDIADLARAGGKPLSMRLRLGVIPTIAPFLLPRALARLRT LYPDLKLALREDLTARLLDRLASGELDAAVLALPYEASEMEMVALATDPFVLVCPPGHPL AARDAVTGGDLAEAELLLLEEGHCLRDHALAACSLPAPKRGEGVLGTSLGTLVQMVASGM GVTLLPMLAVDAGILAGTGLVTRPLAMGGSRRLGLAWRKSSARKDEFRLLGNVLFGR