Protein Info for AMB_RS03005 in Magnetospirillum magneticum AMB-1

Annotation: carbonate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 2 to 27 (26 residues), 19.7 bits, see alignment (E = 4.2e-08) PF00194: Carb_anhydrase" amino acids 42 to 251 (210 residues), 131.9 bits, see alignment E=1.6e-42

Best Hits

Swiss-Prot: 44% identical to CAH_PECCA: Carbonic anhydrase (cah) from Pectobacterium carotovorum

KEGG orthology group: K01674, carbonic anhydrase [EC: 4.2.1.1] (inferred from 100% identity to mag:amb0581)

Predicted SEED Role

"Carbonic anhydrase (EC 4.2.1.1)" in subsystem Carboxysome or Cyanate hydrolysis (EC 4.2.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.1

Use Curated BLAST to search for 4.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9U0 at UniProt or InterPro

Protein Sequence (256 amino acids)

>AMB_RS03005 carbonate dehydratase (Magnetospirillum magneticum AMB-1)
MDRRSFLKGATGAACLCGTCGGSIAEAVAAEGAHWAYEGHGGPKEWGMLSPEYAACSMGR
EQSPVDLTRPIAAIIGDPMAAWRPVPLRVQNNGHTIQVDCSGGGTLMLDGKSYDLLQFHF
HHPSEHTVDGAFFDMECHFVHKAADGGLAVLGVMIAKGAANPALEAIWQVMPAKAGEAAT
ATSMLDASMLLPKDPVTFRYAGSLTTPPCTEVVQWVVYRQAITASAEQLAAFAKLFPNNA
RPVQPLNRRKLLLDVM