Protein Info for AMB_RS02695 in Magnetospirillum magneticum AMB-1

Annotation: undecaprenyl-diphosphatase 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 80 to 103 (24 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 182 to 205 (24 residues), see Phobius details amino acids 217 to 239 (23 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details PF02673: BacA" amino acids 7 to 256 (250 residues), 168.1 bits, see alignment E=1.6e-53

Best Hits

Swiss-Prot: 100% identical to UPPP1_MAGSA: Undecaprenyl-diphosphatase 1 (uppP1) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K06153, undecaprenyl-diphosphatase [EC: 3.6.1.27] (inferred from 100% identity to mag:amb0523)

Predicted SEED Role

"Undecaprenyl-diphosphatase (EC 3.6.1.27)" (EC 3.6.1.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.27

Use Curated BLAST to search for 3.6.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9Z8 at UniProt or InterPro

Protein Sequence (267 amino acids)

>AMB_RS02695 undecaprenyl-diphosphatase 1 (Magnetospirillum magneticum AMB-1)
MTFLEVLVVALIQGLGEVLPFGAAGLLAALPHLAAKPEGRAALSVAAHAGILLALMIYFW
RDVLAMAVGLWRLAKGKPDYGSHLLLHVLAGTIPAAIVGWLVLDRASTLVGQSGAAIILI
LGGVLLWGCDKLGVTVRRVEHMSWVGAAGLGALQILSLVPGVSRTGITVTVARLLGWERQ
AAVRFSMLLAMPLILGHGVKTFWGLAHHTELVFSSDLLMAMATAGLAALIGLAGMMAWVA
RNTFVPFAILRIGFGIAVLGLVYFGQA