Protein Info for AMB_RS02690 in Magnetospirillum magneticum AMB-1

Annotation: dihydropyrimidine dehydrogenase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01318: glutamate synthase, small subunit
  • amino acids 7 to 463 (457 residues), 516.5 bits, E=2.8e-159
• PF14691: Fer4_20
  • amino acids 24 to 135 (112 residues), 118.2 bits, E=7.2e-38
• PF01494: FAD_binding_3
  • amino acids 149 to 181 (33 residues), 22.4 bits, see alignment (E = 3e-08)
• PF03486: HI0933_like
  • amino acids 150 to 183 (34 residues), 22.7 bits, 1.8e-08
• PF00070: Pyr_redox
  • amino acids 150 to 183 (34 residues), 22.8 bits, 4.9e-08
  • amino acids 286 to 362 (77 residues), 27.7 bits, E=1.5e-09
• PF07992: Pyr_redox_2
  • amino acids 150 to 451 (302 residues), 112.1 bits, E=1.7e-35
• PF13450: NAD_binding_8
  • amino acids 152 to 185 (34 residues), 39.7 bits, 2.1e-13
• PF01593: Amino_oxidase
  • amino acids 158 to 185 (28 residues), 20.7 bits, see alignment (E = 1.1e-07)

Best Hits

Swiss-Prot: 66% identical to GLTD_AZOBR: Glutamate synthase [NADPH] small chain (gltD) from Azospirillum brasilense

KEGG orthology group: K00266, glutamate synthase (NADPH/NADH) small chain [EC: 1.4.1.13 1.4.1.14] (inferred from 100% identity to mag:amb0522)

MetaCyc: 66% identical to glutamate synthase beta subunit (Azospirillum brasilense)
Glutamate synthase (NADPH). [EC: 1.4.1.13]

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• ammonia assimilation cycle I (2/2 steps found)
• L-glutamate biosynthesis IV (1/1 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamine degradation II (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• superpathway of ammonia assimilation (plants) (2/3 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-glutamate and L-glutamine biosynthesis (4/7 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13, 1.4.1.14

Use Curated BLAST to search for 1.4.1.13 or 1.4.1.14

Sequence Analysis Tools

See Q2W9Z9 at UniProt or InterPro

Protein Sequence (471 amino acids)

>AMB_RS02690 dihydropyrimidine dehydrogenase subunit A (Magnetospirillum magneticum AMB-1)
MPRKMLQFTHLHQRQPEKRGAAERRKDFGEISTAFGASQAGEQASRCEQCGIPFCSIHCP
LGNNVPDWLMLVAQDRMEEAYAVSSATNTFPEICGRICPQDRLCEGNCVLEQSTHGNVTI
GAVEKHITETAFAEGWVKPVLPGAETGRSVGIVGGGPAGLAAAESLRRKGHAVTVYDRHD
RMGGLLIYGIPGFKLEKDVVERRIRLLAEAGVKFETGVEIGKTVSFAELRARHDAVLIAT
GVYKAKPLGINGADLPGVHAALDYLIAQNRRDLGETVAELDAKGRNVVVIGGGDTAMDCV
RTAIRQGAKSVKCLYRRDRANMPGSKREVAHAEEEGVEFVWMAAPEAVTGAKKAEGVRAV
RMHLGMPDSSGRQSPVAIEGSGFTLASDMVIAALGFDPEDMPVLFGAPELKVSKWGTVET
DATLMTSLPGVFGAGDIVRGASLVVWAIKDGRDAAEAIHRYVSAKSAQAAE