Protein Info for AMB_RS02690 in Magnetospirillum magneticum AMB-1

Annotation: dihydropyrimidine dehydrogenase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 TIGR01318: glutamate synthase, small subunit" amino acids 7 to 463 (457 residues), 516.5 bits, see alignment E=2.8e-159 PF14691: Fer4_20" amino acids 24 to 135 (112 residues), 116 bits, see alignment E=3.1e-37 PF01494: FAD_binding_3" amino acids 149 to 181 (33 residues), 22.4 bits, see alignment (E = 2.7e-08) PF07992: Pyr_redox_2" amino acids 150 to 451 (302 residues), 112.1 bits, see alignment E=1.5e-35 PF00070: Pyr_redox" amino acids 150 to 183 (34 residues), 22.4 bits, see alignment 5.6e-08 amino acids 286 to 362 (77 residues), 27.4 bits, see alignment E=1.6e-09 PF13450: NAD_binding_8" amino acids 152 to 185 (34 residues), 39.3 bits, see alignment 2.5e-13 PF01593: Amino_oxidase" amino acids 158 to 185 (28 residues), 20.7 bits, see alignment (E = 9.4e-08)

Best Hits

Swiss-Prot: 66% identical to GLTD_AZOBR: Glutamate synthase [NADPH] small chain (gltD) from Azospirillum brasilense

KEGG orthology group: K00266, glutamate synthase (NADPH/NADH) small chain [EC: 1.4.1.13 1.4.1.14] (inferred from 100% identity to mag:amb0522)

MetaCyc: 66% identical to glutamate synthase beta subunit (Azospirillum brasilense)
Glutamate synthase (NADPH). [EC: 1.4.1.13]

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13, 1.4.1.14

Use Curated BLAST to search for 1.4.1.13 or 1.4.1.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W9Z9 at UniProt or InterPro

Protein Sequence (471 amino acids)

>AMB_RS02690 dihydropyrimidine dehydrogenase subunit A (Magnetospirillum magneticum AMB-1)
MPRKMLQFTHLHQRQPEKRGAAERRKDFGEISTAFGASQAGEQASRCEQCGIPFCSIHCP
LGNNVPDWLMLVAQDRMEEAYAVSSATNTFPEICGRICPQDRLCEGNCVLEQSTHGNVTI
GAVEKHITETAFAEGWVKPVLPGAETGRSVGIVGGGPAGLAAAESLRRKGHAVTVYDRHD
RMGGLLIYGIPGFKLEKDVVERRIRLLAEAGVKFETGVEIGKTVSFAELRARHDAVLIAT
GVYKAKPLGINGADLPGVHAALDYLIAQNRRDLGETVAELDAKGRNVVVIGGGDTAMDCV
RTAIRQGAKSVKCLYRRDRANMPGSKREVAHAEEEGVEFVWMAAPEAVTGAKKAEGVRAV
RMHLGMPDSSGRQSPVAIEGSGFTLASDMVIAALGFDPEDMPVLFGAPELKVSKWGTVET
DATLMTSLPGVFGAGDIVRGASLVVWAIKDGRDAAEAIHRYVSAKSAQAAE