Protein Info for AMB_RS02665 in Magnetospirillum magneticum AMB-1

Annotation: cobyrinate a,c-diamide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 TIGR00379: cobyrinic acid a,c-diamide synthase" amino acids 19 to 449 (431 residues), 331.3 bits, see alignment E=5.1e-103 PF01656: CbiA" amino acids 19 to 208 (190 residues), 62.4 bits, see alignment E=6.3e-21 PF07685: GATase_3" amino acids 263 to 450 (188 residues), 112.4 bits, see alignment E=3.3e-36

Best Hits

Swiss-Prot: 55% identical to COBB_RHOCB: Hydrogenobyrinate a,c-diamide synthase (cobB) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: K02224, cobyrinic acid a,c-diamide synthase [EC: 6.3.1.- 6.3.5.9] (inferred from 59% identity to rru:Rru_A3359)

Predicted SEED Role

"Cobyrinic acid A,C-diamide synthase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.1.-, 6.3.5.9

Use Curated BLAST to search for 6.3.1.- or 6.3.5.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (456 amino acids)

>AMB_RS02665 cobyrinate a,c-diamide synthase (Magnetospirillum magneticum AMB-1)
MAEGKAGAENRGGAGSKGLIIAAPSSGSGKTTLTLGLLRLLARKGLAVGSVKVGPDYIDP
AFHAAASGRPCYNLDSWAMRPESLGALAARAASGAELLVCEGVMGLFDGAFVPAGQPDGS
TADLAAATGWPVVLVIDGRGMTGSAAAVLAGFAHLRPEVRIGGVIFNRVVGDKHKAAIAA
ACARACPGISLLGFLPPSSGLETPSRHLGLVQAAERADLQTFLDGAAALVAEHVDVDGLA
ALAQPSRLAGGSLGAMIPPLGARIAVARDTAFAFAYPALLEGWRQAGAELSFFSPLADQG
PDEAADAVYLPGGYPELHAGRLAGNAGFLNGLRRAAAAGAVLYGECGGYMVLGRGMEDAQ
GVRHAMAGLLGLETSFARRRLHLGYRRAALYAAGPLGEAGQGYRGHEFHYASVLAEQGAP
LFSVADAPGADLGHAGLVEGRVTGSFVHLIDRFAGS