Protein Info for AMB_RS02475 in Magnetospirillum magneticum AMB-1

Annotation: XRE family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 72 PF13560: HTH_31" amino acids 7 to 64 (58 residues), 53.7 bits, see alignment E=4.3e-18 PF13443: HTH_26" amino acids 10 to 67 (58 residues), 29.5 bits, see alignment E=1.5e-10 PF12844: HTH_19" amino acids 10 to 69 (60 residues), 32.3 bits, see alignment E=1.5e-11 PF01381: HTH_3" amino acids 11 to 65 (55 residues), 45.3 bits, see alignment E=1.4e-15

Best Hits

Swiss-Prot: 38% identical to Y4DJ_SINFN: Uncharacterized HTH-type transcriptional regulator y4dJ (NGR_a04070) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 100% identity to mag:amb0482)

Predicted SEED Role

"Predicted transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WA39 at UniProt or InterPro

Protein Sequence (72 amino acids)

>AMB_RS02475 XRE family transcriptional regulator (Magnetospirillum magneticum AMB-1)
MDLRELFATNLRRLRHDKGLSQDELACDAEMSRSYLAQLETGKYHASLKIIGRLADVLEV
DPVEFLKGPAGR