Protein Info for AMB_RS02205 in Magnetospirillum magneticum AMB-1

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 65 to 89 (25 residues), see Phobius details amino acids 121 to 137 (17 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details TIGR00645: TIGR00645 family protein" amino acids 18 to 175 (158 residues), 184.3 bits, see alignment E=1.1e-58 PF03350: UPF0114" amino acids 23 to 137 (115 residues), 116.6 bits, see alignment E=3.8e-38

Best Hits

Swiss-Prot: 54% identical to Y1258_PASMU: UPF0114 protein PM1258 (PM1258) from Pasteurella multocida (strain Pm70)

KEGG orthology group: None (inferred from 100% identity to mag:amb0426)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WA95 at UniProt or InterPro

Protein Sequence (199 amino acids)

>AMB_RS02205 membrane protein (Magnetospirillum magneticum AMB-1)
MSHQMYGHAGQDSFTRGIARLVFLSRWLQAPLYMGLIVAQTYYVYRFFLEIAEIFHHPAM
DESAAVLLVLGLIDVVMISNLLIMVIIGGYETFVSRLRVEGHPDCPEWLSHVNANTMKTK
LAMALIGISSIHLLKTFVNAEHHMQETVVMWQCIIHTLFIVSAVMLGYLNKLMETSPHGS
HGHGHGHAPAHAQHQPAAE