Protein Info for AMB_RS02190 in Magnetospirillum magneticum AMB-1

Annotation: C4-dicarboxylate ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 651 transmembrane" amino acids 39 to 60 (22 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 178 to 196 (19 residues), see Phobius details amino acids 211 to 247 (37 residues), see Phobius details amino acids 259 to 278 (20 residues), see Phobius details amino acids 302 to 317 (16 residues), see Phobius details amino acids 343 to 367 (25 residues), see Phobius details amino acids 379 to 400 (22 residues), see Phobius details amino acids 437 to 458 (22 residues), see Phobius details amino acids 464 to 483 (20 residues), see Phobius details amino acids 495 to 517 (23 residues), see Phobius details amino acids 537 to 564 (28 residues), see Phobius details amino acids 575 to 597 (23 residues), see Phobius details amino acids 618 to 645 (28 residues), see Phobius details PF04290: DctQ" amino acids 49 to 175 (127 residues), 76.3 bits, see alignment E=2.1e-25 PF06808: DctM" amino acids 218 to 640 (423 residues), 288.5 bits, see alignment E=8.5e-90 TIGR00786: TRAP transporter, DctM subunit" amino acids 225 to 646 (422 residues), 306.5 bits, see alignment E=1.3e-95

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0423)

Predicted SEED Role

"TRAP-type transport system, small permease component, predicted N-acetylneuraminate transporter" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WA98 at UniProt or InterPro

Protein Sequence (651 amino acids)

>AMB_RS02190 C4-dicarboxylate ABC transporter (Magnetospirillum magneticum AMB-1)
MSGGAQHDAILATDTLPAVTVRNPVIAVFEAVMEGAFKLSALALLAAAGVLTFGVVMGHL
TGRGLLWQDEVTVFLISGAVFLSAASVQARRGHVAIDFLDHAFPYAKDLRHAVVEAGILA
FCLIFAWKSGMLLAEAVHEGQTSQSAWGPPLWIPYSVLTLGMALLALQVMLQVGRRSLWL
LAVVVAGVAAFLLATPPVKPLVSGLPHWLTGIAYATVTLLVMFSGMPIAFALGVVALIFM
LLFMPAASVDTIAQNFYEELANVIILAIPLFILKGATIGRSNAGKDLYSALHAWLHRIPG
GLGVANTIACGLFAAMAGSSPATCSAIGSAGIPEMRARGYSPGFAAGIIAAGGTLGILLP
PSVTMLLYAVAAEVSLGRLFLAGIGPGLLLITLFAGYSVLRYRHEYRRAERAAASHGTHS
ALLADEHYTTRQKIRMVVWVAPFVTILAGVMVVLYAGWATPSETAGVGAVLALLVIGLMY
GIWRPRLLMPILTGTLRESTMLLMIIGMSLLYAYVMSHLRISQAAADWIIGLALSKWFLL
AAILLFTVVLGFFLPPVSIILMTAPIILPPLKAAGFDLIWFGVVMTVVMEMGLIHPPVGL
NIFVIKNIAPDIPLRDIIWGTLPFVLIMMVAVVACCLIPGIATWLPGAVMG