Protein Info for AMB_RS01690 in Magnetospirillum magneticum AMB-1

Annotation: serine phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 555 PF13185: GAF_2" amino acids 28 to 166 (139 residues), 61.1 bits, see alignment E=3.4e-20 PF01590: GAF" amino acids 29 to 166 (138 residues), 57.4 bits, see alignment E=5.9e-19 PF13492: GAF_3" amino acids 31 to 166 (136 residues), 32.8 bits, see alignment E=2.2e-11 PF07228: SpoIIE" amino acids 228 to 414 (187 residues), 133.2 bits, see alignment E=3e-42 PF13581: HATPase_c_2" amino acids 428 to 550 (123 residues), 96 bits, see alignment E=4.4e-31

Best Hits

KEGG orthology group: K07315, sigma-B regulation protein RsbU (phosphoserine phosphatase) (inferred from 100% identity to mag:amb0334)

Predicted SEED Role

"Serine phosphatase RsbU, regulator of sigma subunit / Serine-protein kinase RsbW (EC 2.7.11.1)" in subsystem SigmaB stress responce regulation (EC 2.7.11.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.11.1

Use Curated BLAST to search for 2.7.11.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WAI7 at UniProt or InterPro

Protein Sequence (555 amino acids)

>AMB_RS01690 serine phosphatase (Magnetospirillum magneticum AMB-1)
MSSLHASADSASHLDLIVEMTGDFAHSQDVEATLRLGLERIAQRVGAQAASLFLIDDDTG
DLVCRANVGPVDVVGLRLPPGTGIVGRTIDLGAPQLVKDTRRDPDFAQAIDAATGFETRS
ILCAPMMVRGTRLGAIELFNKTDGNAFSLTDSRLLQALAASSALALINARLVADMAEQQS
LKRELELASEIQRAMLPGQQPEQSPIHGINLPASGVSGDFFEIMPLADGRLAFAIGDVSG
KGMKASLLMSKTASLFRCLAKREAGPGPVLAAINAELLETRMPGMFVTMVAGLFDPASGR
GVLAIAGHEQPLLLKNGVFTAIEGEMPPLGIAVELFADGCPEVEFNLDGGSLYLFTDGLT
EARTQHDAMLEDAGARALIASFAPMPAGERLKAMVRSLEDSGGLRDDVTLMVIEDRRRLG
LGFEGRYPARAEELSAIRSALGNAMRGQGCGEAVVGDVVLAVDEACQNIIRHAYKGGEGE
IIVHLDREPNRLVIRLMDFAPAVDVAKIEPRPLDEVRPGGLGTHLIRSVMDSVEFLPPPA
GIGNLLQMVKRIDPT